Home About us Contact
|
Home About us Contact | ||
|
|
||
Strain Rate Sensitivity (strain + rate_sensitivity)
Selected AbstractsStrain rate sensitivity of Cu after severe plastic deformation by multiple compressionPHYSICA STATUS SOLIDI (A) APPLICATIONS AND MATERIALS SCIENCE, Issue 11 2005Y. J. Li Abstract Coarse-grained Cu99.99 was prestrained by ,pre in multiple compression in three orthogonal directions at room temperature. While the flow stress , saturates at ,pre , 2, the strain rate sensitivity of , at 318 K increases by a factor of , 2.7 from ,pre = 2 to 7. This increase is attributed to decrease of grain size and corresponding increase in fraction of high-angle grain boundaries. (© 2005 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim) [source] Effects of temperature and strain rate on the tensile behavior of unfilled and talc-filled polypropylene.POLYMER ENGINEERING & SCIENCE, Issue 12 2002Part I: Experiments The tensile behavior of unfilled and 40 w% talc-filled polypropylene has been determined at four different temperatures (21.5, 50, 75 and 100°C) and three different strain rates (0.05, 0.5 and 5 min,1). Experimental results showed that both unfilled and talc-filled polypropylenes were sensitive to strain rate and temperature. Stressstrain curves of both materials were nonlinear even at relatively low strains. The addition of talc to polypropylene increased the elastic modulus, but the yield strength and yield strain were reduced. The temperature and strain rate sensitivities of these materials were also different. An energy-activated, rate sensitive Eyring equation was used to predict the yield strength of both materials. It is shown that both activation volume and activation of energy increased with the addition of talc in polypropylene. [source] Effect of GDF-7 deficiency on tail tendon phenotype in miceJOURNAL OF ORTHOPAEDIC RESEARCH, Issue 6 2008Borjana Mikic Abstract The subfamily of growth/differentiation factors (GDFs) known as GDFs 5, 6, and 7 appears to be involved in tendon maintenance and repair, although the precise nature of this role has yet to be elucidated. The aim of the present study was to examine the role of GDF-7 in tendon maintenance by studying tail tendon fascicle gene expression, composition, and material property strain rate dependency in 16-week-old male and female GDF-7 deficient mice. GDF-7 deficiency did not affect the biochemical composition of tail tendon fascicles, nor did it significantly affect the tensile material properties obtained at either slow (5%/s) or fast (50%/s) strain rates. Further, no difference was found between genotypes in the strain rate sensitivity of any tensile material property. Consistent with the compositional analyses, QRT-PCR data did not reveal any differences of twofold or greater in the gene expression levels of collagens I, III, V, nor in the proteoglycans decorin, fibromodulin, lumican, biglycan, versican, or aggrecan. Gdf5 expression was upregulated twofold in GDF-7 deficient tail tendons, and Bmp7 expression was downregulated twofold. No notable differences in expression levels for Bmp1-6 or Gdf6 were detected. GDF-5 protein levels were 50% higher in GDF-7 deficient tail tendon compared to wild type tail tendon. The results of this study support the intriguing possibility that compensation by Gdf-5 may be at least in part responsible for the absence of a strong phenotype in GDF-7 deficient mice. © 2008 Orthopaedic Society. Published by Wiley Periodicals, Inc. J Orthop Res 26:834,839, 2008 [source] Theoretical and experimental analysis of plastic response of isotropic circular plates subjected to underwater explosion loadingMATERIALWISSENSCHAFT UND WERKSTOFFTECHNIK, Issue 2 2008J. Z. Ashani Abstract Dynamic response analysis of structures subjected to underwater explosion (UndEx) loading has been always an interesting field of study for ship designers and metal forming specialists. Understanding the deformation and rupture mechanism of simple structures plays an important role in successful designing of a reliable structure under this kind of loading. In this paper, first the major parameters of the UndEx phenomenon (peak overpressure, impulse per unit area, dimensionless damage parameter ,, etc.) are discussed and determined by means of available experimental relations mostly offered by R. Cole. After that, the maximum deflection of a fully clamped circular plate has been calculated using a theoretical procedure assuming two different conditions: (1) neglecting the effect of strain rate, (2) considering the strain rate sensitivity of the material. Some experiments have been conducted on 5010 aluminum circular plates, using C4 as explosive. In order to simulate reality, a fixture was designed so that the plates are loaded in air-backed condition. Plates were fixed on top of the fixture, so the fully clamped condition which was assumed as the boundary condition was achieved. The test specimens were measured, not only their maximum deflection but also their thickness at different radii were determined. The results are compared to experimental-based predictions offered by Nurick and Rajendran who has conducted similar experiments. The results show reasonable agreement with theoretical predictions, especially when strain rate effects are considered. In addition, two new material constants (D, q) for this special aluminum alloy are introduced. Theoretische und experimentelle Analyse der plastischen Umformung isotroper kreisförmiger Platten bei Unterwasser-Explosionsbelastung Die Analyse der dynamischen Reaktion einer Struktur bei einer Explosionsbelastung unter dem Wasser ist für die Konstrukteure von Schiffen und Umformspezialisten eine interessante Forschungsaufgabe. Das Verständnis der Umformung und der Bruchmechanismen einfacher Strukturen spielt eine wichtige Rolle im erfolgreichen Konstruieren einer festen Struktur gegen diese Belastungsart. In diesem Beitrag werden erstens die Hauptparameter der Explosionserscheinung unter Wasser (maximaler Druck, Impulse per Flächeneinheit, dimensionsloser zerstörender Parameter usw.) dargestellt und zweitens durch die vorhandenen Methoden, die überwiegend von R. Cole vorliegen, berechnet. Danach ist die maximale Durchbiegung einer ganz gespannten kreisförmigen Platte durch eine analytische Methode in zwei Formen bestimmt worden: (1) Vernachlässigung der Dehnungsgeschwindigkeit, (2) Berücksichtigung der Dehnungsgeschwindigkeitsempfindlichkeit des Werkstoffes. Einige Untersuchungen wurden an kreisförmigen Platten aus Aluminium 5010 mittels Sprengstoff C4 durchgeführt. Zur Praxissimulation wurde die Spannvorrichtung so konstruiert, so dass die Platten Luft-gepuffert belastet wurden. Die Platten wurden oben auf der Spannvorrichtung vollständig eingespannt, um Grenzbedingungen zu erhalten. Bei den Proben wurde nicht nur die maximale Durchbiegung sondern auch die Dicke in verschiedenen Radien ermittelt. Die Ergebnisse wurden mit den experimentellen Abschätzungen von Nurick und Rajendran, die ähnliche Versuche durchgeführt haben, verglichen. Die Ergebnisse zeigen eine gute Übereinstimmung mit den theoretischen Abschätzungen, insbesondere bei Betrachtung der Dehngeschwindigkeit. Zusätzlich wurden für diese spezielle Aluminiumlegierung zwei neue Materialkonstanten (D, q) eingeführt. [source] Strain rate sensitivity of Cu after severe plastic deformation by multiple compressionPHYSICA STATUS SOLIDI (A) APPLICATIONS AND MATERIALS SCIENCE, Issue 11 2005Y. J. Li Abstract Coarse-grained Cu99.99 was prestrained by ,pre in multiple compression in three orthogonal directions at room temperature. While the flow stress , saturates at ,pre , 2, the strain rate sensitivity of , at 318 K increases by a factor of , 2.7 from ,pre = 2 to 7. This increase is attributed to decrease of grain size and corresponding increase in fraction of high-angle grain boundaries. (© 2005 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim) [source] Effects of temperature and strain rate on the tensile behavior of short fiber reinforced polyamide-6POLYMER COMPOSITES, Issue 5 2002Zhen Wang Tensile behavior of extruded short E-glass fiber reinforced polyamide-6 composite sheet has been determined at different temperatures (21.5°C, 50°C, 75°C, 100°C) and different strain rates (0.05/min, 0.5/min, 5/min). Experimental results show that this composite is a strain rate and temperature dependent material. Both elastic modulus and tensile strength of the composite increased with strain rate and decreased with temperature. Experimental results also show that strain rate sensitivity and temperature sensitivity of this composite change at a temperature between 25°C and 50°C as a result of the glass transition of the polyamide-6 matrix. Based on the experimental stress-strain curves, a two-parameter strain rate and temperature dependent constitutive model has been established to describe the tensile behavior of short fiber reinforced polyamide-6 composite. The parameters in this model are a stress exponent n and a stress coefficient ,*. It is shown that the stress exponent n, which controls the strain rate strengthening effect and the strain hardening effect of the composite, is not only strain rate independent but also temperature independent. The stress exponent ,*, on the other hand, varies with both strain rate and temperature. [source] | ||||||||||